SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0ZZD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0ZZD1
Domain Number 1 Region: 89-222
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.17e-17
Family Protein-L-isoaspartyl O-methyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0ZZD1
Sequence length 424
Comment (tr|A0ZZD1|A0ZZD1_BIFAA) N6-adenine-specific methylase {ECO:0000313|EMBL:BAF38814.1} KW=Complete proteome; Reference proteome OX=367928 OS=NCTC 11814 / E194a). GN=BAD_0033 OC=Bifidobacterium.
Sequence
MSDGPLLNDVTRAFAEAHRNEDVRDLALKTKRTADLDLPAALDQIAGWQIARNKLPQWAA
CADIVYPAHISMEQCSSQFTAQYKAEIARRLLRSLPQSAGQTANDATMTDLTGGFGVDFS
YLARGFGHATYVERQSHLCELAAHNMAALGLTQAQVVCGDGVEYLRAMEPAQLIYIDPAR
RDEHGARTYAIEDCTPDVLALRDLLLAKARYVMIKLSPMLDWRKAVDDFAGTVAEVHIVS
TGNECKELLLVLDGKAAGATSDAAAADTRAPHVYCVNDDQRLDYDAAAYTRGLRIGDAPL
PHELRYLYEPNASIMKAGCFDVVEARFGAVQIGPSSHLFVSDEPVDGFPGRGFAIETIGG
MGKKELKRLLSGLDRANIAVRNFPLTAPQLRKKLKLADGGDAYLFGTTMQGGDHVLIRTA
KISR
Download sequence
Identical sequences A0A174CEZ5 A0ZZD1
APC38931 367928.BAD_0033 gi|119025051|ref|YP_908896.1| WP_011742586.1.36503 WP_011742586.1.43097 WP_011742586.1.6218 WP_011742586.1.64668 WP_011742586.1.76728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]