SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A1A1V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1A1V9
Domain Number 1 Region: 63-249
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.25e-17
Family RNA methyltransferase FtsJ 0.077
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000265
Family Pseudouridine synthase RsuA N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1A1V9
Sequence length 251
Comment (tr|A1A1V9|A1A1V9_BIFAA) Hemolysin-like protein with S4 domain {ECO:0000313|EMBL:BAF39692.1} KW=Complete proteome; Reference proteome OX=367928 OS=NCTC 11814 / E194a). GN=BAD_0911 OC=Bifidobacterium.
Sequence
MNDDSGAVVRLDIALVERGVTDSRSKAQRLIESGKVRVNGTVASKASLKVTAADTLDADL
GDDYVSRGAYKLVGAFDMFSQTGLRSAEGLDCLDIGASTGGFCDVLLRRGAAHVIALDVG
HGQLDPRIAGNERIIEMSGVNIRDVEADDLPYRPSMIVSDVSFISLTYVIPVIARIAAPG
AHVVLLVKPQFEVGKGNLGKNGIVESETLRKQALDTVTACAKANGLDVRATAVSPIEGTH
GNIEYLLYAVA
Download sequence
Identical sequences A1A1V9
gi|119025929|ref|YP_909774.1| 367928.BAD_0911 NYSGXRC-11125m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]