SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1A2Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1A2Z8
Domain Number 1 Region: 28-212
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.04e-54
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00096
Further Details:      
 
Domain Number 2 Region: 201-266
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000111
Family Hydantoinase (dihydropyrimidinase) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1A2Z8
Sequence length 278
Comment (tr|A1A2Z8|A1A2Z8_BIFAA) Putative allantoinase {ECO:0000313|EMBL:BAF40081.1} KW=Complete proteome; Reference proteome OX=367928 OS=NCTC 11814 / E194a). GN=BAD_1300 OC=Bifidobacterium.
Sequence
MAKTDYPTQSTSHIGRIRHRRNGAKPAKWATNAATKSPTVANTVEPASRPAECEANAVRK
IVRLVARTGCRTHILHVSSGLSVDVLRRAKAEGLPVSAETCPHYLTLDCDHIPDNATAFK
CCPPIRDLHEQDALWAGLADGTLDGVVTDHSPASADMKAGTLATAWGGVSSLQVGFRAVL
TGAMRRGLSLTDVVRWMSCNTARLVGLDDRGDITPVLRADLAIIRPYERFVVDATALESR
NPICACDGMTLNGVVTRTFVAGRDALSGVREGNLIVRP
Download sequence
Identical sequences A1A2Z8
367928.BAD_1300 gi|119026318|ref|YP_910163.1| WP_011743619.1.36503 WP_011743619.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]