SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1A308 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1A308
Domain Number 1 Region: 12-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-54
Family Protein kinases, catalytic subunit 0.0000452
Further Details:      
 
Weak hits

Sequence:  A1A308
Domain Number - Region: 397-424
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0224
Family Myosin S1 fragment, N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1A308
Sequence length 473
Comment (tr|A1A308|A1A308_BIFAA) Serine_threonine protein kinase {ECO:0000313|EMBL:BAF40091.1} KW=Complete proteome; Reference proteome OX=367928 OS=NCTC 11814 / E194a). GN=BAD_1310 OC=Bifidobacterium.
Sequence
MEASRSIPPQIPGYTLIKRLGSGSEADVYLYQQLSPARQVAIKISKNTLDPRAAVRFRSE
ANFMGQISTHPYILSVYENGVTVNGRGYTVFEYAPGGNYKTFLEHGRLTADQMLTVGIDL
ASALFTAHRKGIIHRDIKPSNILINAHNMPMLADFGIAGTVYGRPGVGFTIAWAAPEVLA
QGGGGNESSDIYSLGATLFAMLIGQSPYEYFYADVLGDSQRQVRAERLKSVILNNPLPKL
NRSDVPAEVEWVLRKALSRAPEDRYYSALEFARDMQRVQQALYGRAVQTTVEGVPDYPQN
MYAQTSTFDQSAPVAKQHARWVKPLAVTVAAAAAVVVMALAFVTVVMPNMDAASDNSKVQ
VQNHGAQNHAEDDPDSAITSGSVPSVQDLTGEYTADSKVRFTWVNPSPKDGDSYAWSLVG
DSGTDPNAQGTTTESTSIEIDPADGAQTCVQVSLVRADRQMSENPMIACAAKP
Download sequence
Identical sequences A1A308
367928.BAD_1310 WP_011743628.1.36503 WP_011743628.1.64668 gi|119026328|ref|YP_910173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]