SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1D478 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1D478
Domain Number 1 Region: 96-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.93e-69
Family D-glucarate dehydratase-like 0.0000812
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.66e-29
Family Enolase N-terminal domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1D478
Sequence length 383
Comment (tr|A1D478|A1D478_NEOFI) Mandelate racemase/muconate lactonizing enzyme family protein {ECO:0000313|EMBL:EAW23221.1} KW=Complete proteome; Reference proteome OX=331117 OS=A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus). GN=NFIA_019250 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MVKIKSIEYFRVLPRWLFVKIVDEEGQYGWGESTLEGHTEAVEGTLNALCKRFQGYEADD
IEHIWQMAWRLGFYRGGPVFMSAISGIDIALWDLKGRRLGVPVHQLLGGKVRNKLSVYAW
IGGDRPGDVEAAGKARLAQGFKAIKMNATEDINWLDSPSVLDSCVERLKAVKALGLDAAL
DFHGRLHKPMAKQLAKALEPHRPLFLEEPLLSEHPEGIKQLADQVSCPIALGERLYNRWD
VKRFLEDASVDILQPDISHCGGISELRRIASMAETYDVAIAPHCPLGPIALAACMQVDLS
TPNFVIQEMSLGIHYNTEAGEYDITSYVKDPSVFEVKDGYVDALTAPGLGIEVDEEVVRQ
VALKSEPWLCKEFFGPDGGIREW
Download sequence
Identical sequences A1D478
XP_001265118.1.95823 NFIA_019250||mandelate 36630.CADNFIAP00001066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]