SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1SBD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1SBD9
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000235
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1SBD9
Sequence length 93
Comment (tr|A1SBD9|A1SBD9_SHEAM) Uncharacterized protein {ECO:0000313|EMBL:ABM01696.1} KW=Complete proteome; Reference proteome OX=326297 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B). GN=Sama_3493 OC=Shewanellaceae; Shewanella.
Sequence
MSENTVELGSELTIRNIQPIYSQLADLLHQGRPVTLNAARLIKADTAGLQLLLCLQSHCE
NSSIPLNWKGITTELVAQFKQMGMQLPGITSQA
Download sequence
Identical sequences A1SBD9
376492 WP_011761599.1.25267 gi|119776625|ref|YP_929365.1| 326297.Sama_3493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]