SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1SEQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1SEQ6
Domain Number 1 Region: 1-376
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.44e-94
Family Phase 1 flagellin 0.00000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1SEQ6
Sequence length 376
Comment (tr|A1SEQ6|A1SEQ6_NOCSJ) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=196162 OS=Nocardioides sp. (strain ATCC BAA-499 / JS614). GN=Noca_0766 OC=Nocardioides.
Sequence
MSLRINQNIDALNSYRNLSVTQGQMSKSLEKLSSGYRINRAADDAAGLAISEGLRSQVGG
IKVAVRNAQDGVSVVQTAEGALTETHSILQRMRDLSVQAANDSNDVSSRAAIQSENDALV
DELDRIATSTTFNNVSLLDGNYIGKNFQVGYGTGATDSIAVDITSTGTGGAKSTWANGAA
STTAAAATFTHNGVATTTGVLVASTDANNIATQLNADANFKTNYTASVDDKGGLVVTSKD
GLPGAITVSGAGLAGAHVDAAPGANAGFSSTDLGVGALVLDSAANAKAATNAIDTAIKGV
STARAKLGAMQNRFEHTINNLSVTQENLSASESRIRDTDMAAEMMQFTRSQILSQAGTAM
LAQANQAPQGVLQLLR
Download sequence
Identical sequences A1SEQ6
WP_011754240.1.100580 WP_011754240.1.96005 gi|119715013|ref|YP_921978.1| 196162.Noca_0766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]