SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1T5P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1T5P0
Domain Number 1 Region: 31-133
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000746
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1T5P0
Sequence length 147
Comment (tr|A1T5P0|A1T5P0_MYCVP) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ABM12490.1} KW=Complete proteome; Reference proteome OX=350058 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1). GN=Mvan_1661 OC=Mycobacterium.
Sequence
MPHVPDQHPAPPAPVSDNVVCHTARFETRWPQPDTAIVSGLGELDAANGIDFVGYALRHS
DRAHWLVVDLSGLTFFSTAGFSALHTLNVQCVSEDIRWALVPSKAVDRLLRICDPDHALP
TCADVPTALTVVQQEPPRSLQLVAESR
Download sequence
Identical sequences A1T5P0
WP_011778915.1.45031 WP_011778915.1.58012 350058.Mvan_1661 gi|120402667|ref|YP_952496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]