SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1VUR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1VUR1
Domain Number 1 Region: 472-582
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1VUR1
Sequence length 620
Comment (tr|A1VUR1|A1VUR1_POLNA) Sulphate transporter {ECO:0000313|EMBL:ABM39389.1} KW=Complete proteome; Reference proteome OX=365044 OS=Polaromonas naphthalenivorans (strain CJ2). GN=Pnap_4099 OC=Comamonadaceae; Polaromonas.
Sequence
MKPSNASAAIPFTTLMRRLAERLFGHWVHQLTPATLRADAMAGLLGAVLVLPQGIAFATL
AGLPPEYGLYTAIVPCIIAALFGSSWHVMSGPTNANSLALFAMLSPLAMAFSPMYIQLAL
AVTVMVGVLQWLIGALRLGVLANFISPAVLFGFTSGAALLIAVHALPDFLGLAAAPEHSA
AGVLAHVLTQLPHANPAALAVAGITLAVALGLRRFRRNWPYMLIGLAVATVLAWGWGQWT
AGSATPSSALRTVGAIATPWPRFEVPRISWAQASDLIGLAFALTIVALGQDISIAKTVAL
RSGQRIDANREFRGQGLSNIIGGFFSSYVSCGSMNRSMPNLEAGARTPLSSVFSALLLLG
LVAVSAPVLAQIPMAALAGLLVLVALALLDLKRWRQLFALSRTDFGVALATLVATLTIRL
EMAILLGMLLSLMSFLYRTSRPAMRTMGFDSRGLDRQFVVIDTPDDPGEPPHPTLPECPQ
LKLLRMEGEVYFGATQHVADILHALRSQPNPQKHLLVMAKSMNFIDLAGAELWQAELAAR
RAMGGDLYFHRPRPEVIRMWRKTGFTDVLGPEHQFPDKFTAISTIFGKLDPEICRHCSAR
IFWECRAAPGADDPANQPTT
Download sequence
Identical sequences A1VUR1
WP_011803451.1.22642 365044.Pnap_4099 gi|121606981|ref|YP_984310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]