SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1WXY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1WXY5
Domain Number 1 Region: 38-141,193-252
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.24e-26
Family Clp protease, ClpP subunit 0.053
Further Details:      
 
Domain Number 2 Region: 424-488
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000222
Family NfeD domain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A1WXY5
Sequence length 490
Comment (tr|A1WXY5|A1WXY5_HALHL) Nodulation efficiency protein NfeD {ECO:0000313|EMBL:ABM62547.1} KW=Complete proteome; Reference proteome OX=349124 OS=halophila (strain DSM 244 / SL1)). GN=Hhal_1783 OC=Ectothiorhodospiraceae; Halorhodospira.
Sequence
MWIRRLLAVLLAYFLSAVPLGSAETPPDAGEDAAGTALMLDVKGAIGPATTDYIVRGLAE
AQERGAGLVILRMNTPGGLDDAMRDIISEILASDVPVATYVAPSGSRAASAGTYILYASH
VAAMAPATNLGAATPVQIGGGGGGIFPGGDDEEQGGDALEELRERLGGEEEDVDEEAREE
DEAVEQEEPAEERADRPDAMERKIIEDAVSYIKGLAELRGRNAEWAERAVRESISASASE
AAELGVIDFVAEDVDELLAKADGVVVKLPGGERAIESAGLEVDLVEPDWRNRLLSVITNP
NVAYILMLVGIYGIIFELINPGSLVPGVLGGISLLLALYAFQALPITYAGLGLIGLGIAF
MIAEAFMPSFGIMGIGGAVAFVLGSIMLFDTDLEAFQVSLGVIAGFTVASLIIFIGVAMM
AARAWQRPKLGGADELIDAEAIAEESFEGAGHVRYAGERWNAVAVSPVRSGERVRVVSKE
GLTLKVEPND
Download sequence
Identical sequences A1WXY5
gi|121998562|ref|YP_001003349.1| 349124.Hhal_1783 WP_011814569.1.47253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]