SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1Z9G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z9G2
Domain Number 1 Region: 481-637
Classification Level Classification E-value
Superfamily TPR-like 1.26e-22
Family HAT/Suf repeat 0.057
Further Details:      
 
Domain Number 2 Region: 205-486
Classification Level Classification E-value
Superfamily TPR-like 1.57e-20
Family HAT/Suf repeat 0.028
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000542
Family HAT/Suf repeat 0.02
Further Details:      
 
Domain Number 4 Region: 646-724
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000569
Family HAT/Suf repeat 0.091
Further Details:      
 
Domain Number 5 Region: 23-78
Classification Level Classification E-value
Superfamily TPR-like 0.000000024
Family HAT/Suf repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1Z9G2
Sequence length 883
Comment (tr|A1Z9G2|A1Z9G2_DROME) Fandango {ECO:0000313|EMBL:AAF58348.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6197 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVTKTIKSLNLEINFEVEDVPYEEEILRNAYSVKHWLRYIDHKAKAPNNGVNMVYERALK
ELPGSYKIWHNYLRTRRKQVRGKIPTDPMYEEVNSAFERALVFMHKMPRIWMDYGAFMTS
QCKITRTRHVFDRALRALPITQHGRIWPLYLQFVRRFEMPETALRVYRRYLKLFPEDTEE
YVDYLQEADRLDEAAQQLAHIVDNEHFVSKHGKSNHQLWNELCDLISKNPHKVHSLNVDA
IIRGGLRRYTDQLGHLWNSLADYYVRSGLFDRARDIYEEAIQTVTTVRDFTQVFDEYAQF
EELSLNRRMEQVAANEAATEEDDIDVELRLSRFEYLMERRLLLLNSVLLRQNPHNVHEWH
KRVTLYEDKPAEIISTYTEAVQTVQPKQAVGKLHTLWVEFAKFYEANGQVEDARVVFERG
TEVEYVKVEDLAAVWCEWAEMELRQQQFEAALKLMQRATAMPKRKIAYYDDTETVQARLH
RSLKVWSMYADLEESFGTFKTCKAVYERIIDLKICTPQIIINYGMFLEEHNYFEEAYRAY
EKGISLFKWPNVYDIWNSYLTKFLERYGGTKLERARDLFEQCLDQCPPEHAKYFYLLYAK
LEEEHGLARHAMSVYDRATSAVKEDEMFDMYNIFIKKAAEIYGLPRTREIYEKAIESLPE
QNMRHMCVKFAELETKLGEVDRARAIYAHCSQVCDPRITADFWQTWKEFEVRHGNEDTMR
EMLRIKRSVQATYNTQVNMMAAQFLSTNNGAAADAGAGAGPDAMRLLEEKARQAAAESKQ
KPIEKAASNIMFVRGETQGGAKDKKDTVVNPDEIDIGDSDEDDEEEDDDEENEMTNENQA
SAAVTKTDEEGLVMKKLRFEQKAIPAKVFGSLKPSNQGDSDGE
Download sequence
Identical sequences A1Z9G2
7227.FBpp0086749 FBpp0086749 7303287___KOG2047 FBpp0086749 NP_610891.1.81976 FR707 FBpp0086749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]