SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1Z9Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1Z9Q7
Domain Number 1 Region: 47-187
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000128
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A1Z9Q7
Sequence length 195
Comment (tr|A1Z9Q7|A1Z9Q7_DROME) IP07182p {ECO:0000313|EMBL:ACR78578.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG30075 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLPNDKKGFKAAKNDKFSTHALLNENDNDQSLSSDEQDDIFFLIYRKAHTLFQAGKLWMR
RMRYHDAQRAFEKAITRLKTCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVM
KELRLLTINNPSALALCQHGRALSDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRI
TELEDTNQMLSQLSI
Download sequence
Identical sequences A1Z9Q7
7227.FBpp0086683 FBpp0086683 NP_725390.1.81976 FBpp0086683 FBpp0086683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]