SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A1ZBP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A1ZBP5
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily TPR-like 0.00000901
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  A1ZBP5
Domain Number - Region: 451-522
Classification Level Classification E-value
Superfamily TPR-like 0.0794
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A1ZBP5
Sequence length 580
Comment (tr|A1ZBP5|A1ZBP5_DROME) FI19322p1 {ECO:0000313|EMBL:AFB40596.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG15128 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTSIVEMPRANLEEALPPWMKIDWSDEVLHDIYRDWGTYYSRRRRENFALHYLNKALALE
PTDHMTLYKRCQSKRKAAQMLGALDDSRAAAKLARSKDGEEKAIINLDICDVLYELNQFE
NSKAEMHNNMRVFIGNKRKSFEQRQLVVDGVIKDVTGEAMSAFFTKNLKTVSIVHDLIKE
RERVDNRPLWKRLKEQGKCDVQSIPEVPEEMLSPMEIARRKRAFNIFHQSYINDSWIDVL
FMKMLCKNPNLLLPQCKESSYFLQQLSSKQYEIVRKFMKMLQSRSPLYLVNYLKYGNKAM
SDKYREAYLFRVQYQTHRNMNHALKEIRALRKAKKVQQLAKFVEELMGTYVVLKTARVMC
WKFEFLNEVYNTMALTLAEQLRVPKGFTPYGSNAILKLLRLPVERVKDFVPVTFGDRAPE
PEGNDPATTRAKRLTARLEHRMVFAKYSIEKCYLLHQISQSYLDQGRHSECTYNARKAIK
ESKNCNSNLWKFLSVVQIVKANAILHKLEQTKEALEDALPIAHFLKSSELILFIENCMAC
NTEDSINKRATLMQARRVSKSESVATHSLVSGQDVDSQGG
Download sequence
Identical sequences A1ZBP5
FBpp0085676 7227.FBpp0085676 FBpp0085676 FBpp0085676 NP_611441.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]