SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2BKL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BKL1
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily SIS domain 2.92e-21
Family mono-SIS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BKL1
Sequence length 301
Comment (tr|A2BKL1|A2BKL1_HYPBU) Conserved Sulfolobus protein {ECO:0000313|EMBL:ABM80522.1} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0666 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MANLAKYILSELERINAIVSEQLEHTKPLLEGAECIAAIGAGDSYAAALALEACSGGTAE
ALDPFDALYSGRLGRLARKGCILVALSVGGRTRAVLDVAQRYRELGGRVVAVTGPGTPLA
SLANDAVELVYTGLASGIGAARHVAMLAALAGLLGAQPQVANLDAPCELARADAYAGACE
AYSSAHYAELKRAEVWGEAAPSHRLEQLVHAPIYTAKTVAVYESSIASRDRQREALETLR
EAGFQVYTVPATGDCWSTILSQAAATLYCIAVRAENEKVEEPAYRRHPGLEHLTRLIYEM
S
Download sequence
Identical sequences A2BKL1
415426.Hbut_0666 WP_011821840.1.50451 gi|124027547|ref|YP_001012867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]