SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2BKY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BKY6
Domain Number 1 Region: 9-276
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 1.7e-36
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2BKY6
Sequence length 294
Comment (tr|A2BKY6|A2BKY6_HYPBU) Inositol-1-monophosphatase {ECO:0000313|EMBL:ABM80647.1} KW=Complete proteome; Reference proteome OX=415426 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5). GN=Hbut_0794 OC=Pyrodictiaceae; Hyperthermus.
Sequence
MELPERRSLEDLRRLAVRVAGEAAAFLRDRFGIEEVLHVVTVHEHDSDEGMRIDVESERN
IVELLHAEGFRGIFVGEESGVVKLGNDPLLVVADPLDGSKNYASLIPWSAVSIAIALVEN
GDARLSSIVAGAIAPVFPWPILSFARGHGAFEGGARVKLQQNDRLVLAYVETPEQARAVH
SYLALTGDKRSVRALGSASLEIAWAGMGRAELFVDVRGRLRTVDVAAAVWFAAEAGAKVI
VERSDVSLLSIERVGSVVVTASSTAWSRILEALRSSGFTGLASKTPLSTWGKPA
Download sequence
Identical sequences A2BKY6
415426.Hbut_0794 gi|124027672|ref|YP_001012992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]