SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2BUI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BUI5
Domain Number 1 Region: 145-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.97e-122
Family Enolase 0.0000000355
Further Details:      
 
Domain Number 2 Region: 8-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.13e-52
Family Enolase N-terminal domain-like 0.00000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2BUI5
Sequence length 430
Comment (sp|A2BUI5|ENO_PROM5) 2-phosphoglycerate dehydratase {ECO:0000255|HAMAP-Rule:MF_00318} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_02371; OC=Prochlorococcus.
Sequence
MKETIDFLIDTIEARQVLDSRGNPTVEAEVFLECGAIGRAIVPSGASTGAHEAHELRDGG
TKYMGKGVLDAVNKIHETISPALCGLSALDQTIIDKLMIEIDGTPNKSNLGANSILAVSL
ANARAASKALDMPLYRYLGDPLSNLLPVPLMNVINGGAHAPNGLDCQEFMLVPHGVKTFS
EALRMGTEIFHSLKSLLDKKGLSTAVGDEGGFAPELSSCEAAGDLLLEAIQKAGFIPGKQ
VSLALDVASTEFYRDGFYKYEGTNLTSSQMISYLSNLVSNYPIVSIEDGLGEDDWEGWAA
LNKEIGHKVQLVGDDLFVTNTERLRKGILEKSANSILIKVNQIGTLTETLEAMDLAKSAG
FTSVISHRSGETEDTTIADLSVATRAGQIKTGSLSRSERIAKYNRLLRIEEELGNQARFA
GDLGLGPKNI
Download sequence
Identical sequences A2BUI5
167542.P9515_02371 gi|123965472|ref|YP_001010553.1| WP_011819560.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]