SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2BUV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2BUV2
Domain Number 1 Region: 112-215
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 8.5e-28
Family Cell-division inhibitor MinC, C-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2BUV2
Sequence length 222
Comment (tr|A2BUV2|A2BUV2_PROM5) Probable septum site-determining protein MinC {ECO:0000256|HAMAP-Rule:MF_00267} KW=Complete proteome OX=167542 OS=Prochlorococcus marinus (strain MIT 9515). GN=P9515_03541 OC=Prochlorococcus.
Sequence
MKLILRNSNNDFIKSISFAKFEAYQNFISELSSIKEPVEAHLFTANERITSNELAKLKFH
LKQLNIKFSDIYSNNRETVLSGKSLKINSSLLNNKKNINKSFLDNQSQKKDILHKGTIRS
GDRISSNGDLFIMGDVNPGAIVSANNNVYVWGKLLGTAFAGENGNKNASIASLWLNPIQL
RICEIIAIGPKEKPKHQYPEIAILEAKKIIIKPYEPIRDCNK
Download sequence
Identical sequences A2BUV2
WP_011819671.1.83733 167542.P9515_03541 gi|123965589|ref|YP_001010670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]