SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2RRV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2RRV5
Domain Number 1 Region: 138-441
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-84
Family Ras GEF 0.000000000266
Further Details:      
 
Domain Number 2 Region: 8-177
Classification Level Classification E-value
Superfamily Histone-fold 2.48e-54
Family TBP-associated factors, TAFs 0.00000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2RRV5
Sequence length 713
Comment (tr|A2RRV5|A2RRV5_DANRE) Zgc:158274 protein {ECO:0000313|EMBL:AAI31871.1} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=zgc:158274 OC=Cyprinidae; Danio.
Sequence
MQAPPFQYDFYSEENAHKWRGLLVPSLNKVLNQVHPKLSSQQEALQYIEGLILVLLNTLC
QAQPRTVQDVEERVQRSFPHPIEKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMLHPIE
IARQLTLLESDFYRAVQPSELVGSVWTKEDKEINSPNLLRMIRHTTNLTLWLEKCIVETE
NVEERVSVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEE
AHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGTELINFSKRRK
VAEITGEIQQYQNQPYCLRVENDIRKFFENLNPMEDMMEKEFTDYLFNKSLEIEPRNART
LPRFAKKYSCPLKSPGVRPSAVRPGAMRHPTPLQNEPRKISYSRIPDSETESSAASAPNS
PRTPLTPPPASAASTDTCSVFDSPQQPSSPFHSNSECVFAPVALPHGPRSSSVSSMMGFL
RNDDPPVPPPVPPRRRPESAPAESSPSKMMSTHLDSPPAIPPRQPTSSKVYSPRYSLTDP
PESPPLLPPREPVRTPDVFCSSPLHLQPPPPGRRAPELQAFFPPQTPSPSPLGPRKHPEP
PPEPPLGPPVPPRLSTAGPPAHIPKLPPKTYKRESVHREGPPPPLLLENANPT
Download sequence
Identical sequences A2RRV5
ENSDARP00000062268 NP_001076462.1.45394 ENSDARP00000062268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]