SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2SI84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2SI84
Domain Number 1 Region: 643-811
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 2-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 143-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.94e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 
Domain Number 4 Region: 532-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2SI84
Sequence length 819
Comment (tr|A2SI84|A2SI84_METPP) Assimilatory nitrite reductase (NAD(P)H) large subunit {ECO:0000313|EMBL:ABM95273.1} KW=Complete proteome; Reference proteome OX=420662 OS=Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1). GN=Mpe_A2317 OC=Methylibium.
Sequence
MKKMKLVMVGNGMAGVRTLEELLKIAPDLYDITVFGAEPHPNYNRILLSPVLAGEQTVDE
IILNPLDWYAEHGIALHLGKKVTEIDRVKRIVRASDGTEAEYDRLLIATGSNPFILPVPG
KDLEGVIAYRDIADTNTMIQTAEKYRHAVVIGGGLLGLEAANGLMLRGMQVTVVHIMPWL
MERQLDDVAGRLLQKSLEDRGLKFLIGAQTEQLIGDKDGRVMAVRFKDGQEIPADLVVMA
AGIRPNTELALKAGLHCFNDGRGGIVVTDTLQTVTDPRIYSVGECAAHRGIAYGLVAPLF
EQGKVCATHLAQFGIGRYTGSLTSTKLKVTGIDLFSAGEFMGGTDTEEIVMSDPFGGVYK
KLVIKDDKLVGACLYGDTVDGSWYFKLLREGRSVADIRDKLMFGESNIGDTGHEGHSKAA
AMADSDEVCGCNGVTKGAICKAIKEKGLFTLEEVKKHTKASASCGSCTGLVEQLLMFTAG
GDYSAAPTKKAMCGCTDYSHAEVREAIRTVPSDGSKLLTVDGVYKALNWRTPNGCSSCRP
AVNYYLISTWPKEARDDPQSRFINERSHANIQKDGTYSVIPRMWGGETTASELRRLADAV
DKYKIPTVKVTGGQRIDLLGVKKEDLPAVWKDIGMPSGHAYAKALRTVKTCVGSEWCRFG
TQDSTQMGKDLERAMWRMYAPHKVKFAVSGCPRNCAEAGIKDVGIIGVDSGWEMYVAGNG
GIKTEVAHFFVKLKTPEEVLEYTGAFCQLYREEGWYLERTVHYVNRVGLDYVKKKILDDA
EGRKALWERLQFALDGEPDPWFEFDKAEVDKRQFDALNA
Download sequence
Identical sequences A2SI84
gi|124267504|ref|YP_001021508.1| WP_011829910.1.77188 420662.Mpe_A2317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]