SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2SPH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2SPH0
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A2SPH0
Sequence length 176
Comment (tr|A2SPH0|A2SPH0_METLZ) Pyruvate ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:ABN06226.1} KW=Complete proteome; Reference proteome OX=410358 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z). GN=Mlab_0048 OC=Methanocorpusculaceae; Methanocorpusculum.
Sequence
MYEIRIHSRGGQGGVTAARMMATAAVKDGKFATACPFYGAERRGAPIVSFVRIDDAPVRI
YSQINKPDMIVILDPTVMDTVNVLDGLKEGGSIFINTHDDVDFPAGFKVYKADLTGIALR
ENLVVAGSPIVNTPVIGALAKLGLFSRESGVKAITETFADPRNTAAAKAAYEEVIV
Download sequence
Identical sequences A2SPH0
410358.Mlab_0048 WP_011832427.1.86236 gi|124484877|ref|YP_001029493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]