SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2SR80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2SR80
Domain Number 1 Region: 240-580
Classification Level Classification E-value
Superfamily SIS domain 1.58e-90
Family double-SIS domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 2-219
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.49e-65
Family Class II glutamine amidotransferases 0.00000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2SR80
Sequence length 580
Comment (tr|A2SR80|A2SR80_METLZ) Glutamine--fructose-6-phosphate transaminase {ECO:0000313|EMBL:ABN06836.1} KW=Complete proteome; Reference proteome OX=410358 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z). GN=Mlab_0664 OC=Methanocorpusculaceae; Methanocorpusculum.
Sequence
MCGIVGYIGYHEAAPICTNGLLSLEYRGYDSFGIATLAPSLSVYKHLGKISDAKTSASHL
TGTIGIGHTRWATHGVPSEINAHPHLDEAGKIAVVHNGIIENYAELKRGLEERGVVFTSQ
TDTEVIPHLIAEKYSGNLFEAVSGIIPLLEGSYALLILAEGEEKIVAVRKGSPLVLGIGD
QEFILGSDALPLLEYTRNAVYFEDGDIAEIGRGEYRIHNTGVPVSREITEIEWSGDEVRK
GGFRHFMLKEIYEQPDAFANTLSSVKRCSEIVDSIKKARSITVVACGTSANASLVFSYLM
ESVCHIPTRVVLGSEFKYFPTPGTDLVIGVSQSGETADTIAALKLAKSLGAQTIAVTNVL
GSSITRVASSVLYTRAGPEISVAATKSFISQVAAFMQIVNLLTDHSLEAELAEVRRYIPD
VFTIDLSKAVDICKDAATLLYIGRGMFYPAALEGALKMKEISYIHAEGYAAGELKHGPFA
LLSLETPVIGLCFSSTVYPVMMSNLKEVKARSAPLIVIGKEHDADLEEVADVCIMLPDVS
EYGSVILSSIILQLLAYHTAVALERDVDMPRNLAKSVTVE
Download sequence
Identical sequences A2SR80
WP_011833037.1.86236 gi|124485487|ref|YP_001030103.1| 410358.Mlab_0664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]