SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2TXM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2TXM9
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-50
Family PP-loop ATPase 0.0000361
Further Details:      
 
Domain Number 2 Region: 347-432
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000419
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A2TXM9
Sequence length 436
Comment (tr|A2TXM9|A2TXM9_9FLAO) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=313598 OS=Polaribacter sp. MED152. GN=MED152_09965 OC=Flavobacteriaceae; Polaribacter.
Sequence
MLQKFKNHINKNFPFLKDKKLLIAISGGLDSVVLTHLFHQLNIAEIALAHCNFKLRNKAS
DLDEEFVNKLSQITSNQIFIKSFQTEKISENQKKSIQITARELRYNWFQELMDEHQLDYI
LTAHHADDNLETFLINLTRGSGLDGFTGIPAINGNIVRTLLPFSRSEILNFAKSNNIEWR
EDASNASIKYVRNKIRHKVIPVLKEINPSLLESFSNSIHHLKEVQEIVNDKIVDVTKQSV
VKEKESIKIDIQKIKELANPKAYLYQILKEYHFTEWNDVYHLLDSQSGKAVYSKTHRLLK
DRSFLILSKLENNTNEVYRITENDVLISQPLNLNFQEVTEIKPQNKHSIYVDKDLLNYPL
YLRKKQNGDYIYPSGMQGKKKLSKYFKDEKFSLLDKENTWLLCNSENAIVWVIGYRQDRR
FMATTSTKNYLKINKL
Download sequence
Identical sequences A2TXM9
WP_015481735.1.7039 gi|472322476|ref|YP_007671980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]