SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A2VEQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A2VEQ2
Domain Number 1 Region: 127-238
Classification Level Classification E-value
Superfamily TPR-like 8.35e-16
Family Tetratricopeptide repeat (TPR) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A2VEQ2
Sequence length 250
Comment (tr|A2VEQ2|A2VEQ2_DROME) IP18358p {ECO:0000313|EMBL:ABN49397.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG34274 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPLTTNTVDKKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENA
NKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPD
DRVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKL
REFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFEYSVDRARRFNRSDADFID
EFLDKMRSLL
Download sequence
Identical sequences A2VEQ2
7227.FBpp0111383 FBpp0111383 FBpp0111383 FBpp0111383 NP_001097807.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]