SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3CYD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3CYD3
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3CYD3
Sequence length 142
Comment (tr|A3CYD3|A3CYD3_METMJ) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ABN58383.1} KW=Complete proteome OX=368407 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1). GN=Memar_2462 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MLYAPGEKRAIFLLSHRKTTMDVTVSERDDTAVVSVDGRIDAESAKRLDTVIAGVLARGG
KRVLVNLEKAAYMSSSGLRVLLGKFRDLRRVDGEMALCAVQPDVYKVFLMAGVHEVFPIY
VGLDEILAAGDEEKREEESTSP
Download sequence
Identical sequences A3CYD3
gi|126180400|ref|YP_001048365.1| 368407.Memar_2462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]