SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DK36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DK36
Domain Number 1 Region: 790-1177
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.52e-134
Family PFOR PP module 0.00000000363
Further Details:      
 
Domain Number 2 Region: 417-670
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.01e-91
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000264
Further Details:      
 
Domain Number 3 Region: 6-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.15e-80
Family PFOR Pyr module 0.0000000173
Further Details:      
 
Domain Number 4 Region: 262-415
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.67e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000797
Further Details:      
 
Domain Number 5 Region: 669-835
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.81e-22
Family Ferredoxin domains from multidomain proteins 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DK36
Sequence length 1178
Comment (tr|A3DK36|A3DK36_CLOTH) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=Cthe_3120 OC=Ruminiclostridium.
Sequence
MKKVQKFETMDGNQAAAYASYAFTDVATIYPITPSSPMAETVDEWAAHGKKNIFGQPVRV
VQMQSEAGAAGAMHGSLAAGALTTTYTASQGLLLMIPNLYKMAGELLPGVLHVSARAIAT
HALSIFGDHQDVMACRQTGVALLASSNVQEAADLGYVAHLSAIKSRVPFIHFFDGFRTSH
EYQKIGLIEYDELAKLVDHNAIKEFRDRALNPEHPVARGTAQNPDIYFQGREVQNKFYDN
VPDIVAGYMQEIKRITGREYRPFDYYGAKDAEYVIVAMGSVCDTIDETIDYLMAKGEKVG
SVRVHLYRPFSEKYFFDVIPKTVKKIAVLDRTKEPGAPGEPLYLDVSKMYLSKENRPVIV
GGRYGLGSKDTRPSQIISVFENLKQDEPKNNFTIGIVDDVTNLSLPEGDIIETTPQGTIS
CKFWGLGSDGTVGANKSAIKIIGDNTDLYVQGYFSYDSKKSGGTTISHLRFGPKPLRSPY
LVYNADYIACHNKSFIYNYDILKGLKKGGTFVLNCPWSEEELDKHLPASMKRYIANNDIK
FYIIDALKIASDIGLGNRINMVMQSAFFKLANIIPIEDAVKYLKDSIEKTYGKKGHKIVE
MNNAAVDKGQEALIKVNVPESWKNAVDEEVPVKKEEPEFVKKIQRVMARNEGDELPVSAF
LGMEDGTHPLGTTAYEKRGIAPMIPEWQIDKCIQCGQCSFVCPHSTIRLFLLNDEELSRA
PETFTTKKAIGKGFENLHFRVQVSPLDCTGCGNCADVCPTKEKALIMKPAEEQIEKQADN
WEFAMTVTQKDNLLDRNTLKGSQLVRPLLEFNGACPGCGETPYVRLLTQLFGERMMIANA
TGCSSIWGASSPSIAYTTNAEGKGPAWANSLFEDNAEFGFGMYLAVKQIRERLADLMQMA
VNSDIDEKVKNAFREWLDNKDEAEGSKTATKHIFEALKDYDYKGNRIIEEIMEKKDYLIK
KSIWMIGGDGWAYDIGYGGLDQVLSSGEDVNILVLDTEVYSNTGGQSSKATPTAAVAKFA
AAGKRVRKKDLGLMAMSYGYVYVAQIAMGANMNQTIKAMVEAESYKGPSLIIAYSPCISH
GIKTGMGTSIFEEKRAVEAGYWHLYRYNPMLKEQGKNPFILESKEPTTPYKEFLKGEIRY
SQLANVFPDVAGEMFDAAERDARERYETYKRLAEQKYS
Download sequence
Identical sequences A3DK36
203119.Cthe_3120 gi|125975598|ref|YP_001039508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]