SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DLM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3DLM7
Domain Number - Region: 53-193
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.000981
Family Haloperoxidase (bromoperoxidase) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DLM7
Sequence length 197
Comment (tr|A3DLM7|A3DLM7_STAMF) Uncharacterized protein {ECO:0000313|EMBL:ABN69537.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0426 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MFNNGIKTKIHEYISAMFSAPFIALYILLRLAIDKIIDDFLAFTILFIGLVIIPLIFPLF
IAFRRGYEWDYPNRSTRIYPFSIVTIFYFITLALILYLRCSNEIIFLALSYSVNGFVSLL
ISLKYKISIHLVGITGPATYFYFLGYWIDAIILYLIAFITAYSRFYLRRHTIPQLIMGVM
VGITFTYISYLIVYSGV
Download sequence
Identical sequences A3DLM7
399550.Smar_0426 WP_011838728.1.69113 gi|126465336|ref|YP_001040445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]