SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DLT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DLT2
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily GlnB-like 2.56e-37
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DLT2
Sequence length 110
Comment (tr|A3DLT2|A3DLT2_STAMF) CutA1 divalent ion tolerance protein {ECO:0000313|EMBL:ABN69592.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0484 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MIKGGWIIVFITASNYEEAKKIAEGIVKEKLGACVNIVDKIHSIYWWQGRVEEGNESLLI
IKTRLDKFGKLVEYVKEKHSYEVPEIVAIPLIIGFAKYLDWLDEVVNSSK
Download sequence
Identical sequences A3DLT2
WP_011838783.1.69113 gi|126465391|ref|YP_001040500.1| 399550.Smar_0484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]