SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DLZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DLZ6
Domain Number 1 Region: 142-360
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.7e-64
Family Creatinase/aminopeptidase 0.0000115
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000802
Family Creatinase/prolidase N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DLZ6
Sequence length 368
Comment (tr|A3DLZ6|A3DLZ6_STAMF) Peptidase M24 {ECO:0000313|EMBL:ABN69656.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0549 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MKPQINKLYELIEKSSVEEVLLTAPDNIEYFLGIRTIADSVLLLHYRKGDNLRIYVPLLE
YYRFRDSLSKLGVEVIAVSKTVKPSDARIVESDWKTLIGKLVSSDKVGFDKSHVSPLNTL
ITSIYGDRIVDLSKTINQYRMKKEDWEIRSITRAVEITSKGIYEVANNLNERITEAEVAG
FFEYRVRREGIDEYAFPPLTLFKPGNSYPHNLPSNTRLGRRNLVLVDVGVKYNGRCSDIT
RMIIWGRISEEERKTIEAVNKAVDNVIDNIQPGIEAGKLAEIAVKTLEKHGLSEKFIHGL
GHGFGVLVHEPPYIRIGEKTKLEPGMVFTVEPGVYFAGKYGVRIEEDVLVTKRGVRVLSK
MIERVITP
Download sequence
Identical sequences A3DLZ6
gi|126465455|ref|YP_001040564.1| WP_011838847.1.69113 399550.Smar_0549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]