SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DM03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DM03
Domain Number 1 Region: 206-280
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000432
Family Multidrug resistance efflux transporter EmrE 0.0099
Further Details:      
 
Weak hits

Sequence:  A3DM03
Domain Number - Region: 47-143
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000106
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A3DM03
Sequence length 285
Comment (tr|A3DM03|A3DM03_STAMF) Uncharacterized protein {ECO:0000313|EMBL:ABN69663.1} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0556 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MRNNYPSILKHYLALLGTVILWGTSFPVIKILVSNVDEYTYVWVRGLLSIIFLTPLILFY
ISKKYVSKECVKGGLLAGIFYGLGLFFQGWGTSYTTASNSAFITGLNVLFVHLIVASMYK
RYSIRLFASLVSGILGLYLLSSPTTIGRLGDFLVLIGAVMWALQIIVFDKYSKCNPFILV
YFMFTPTQTFILFDPSPADILETRINVLLGFIYLAIFCSIGAFALQAYGQKKVPPETAAT
IFLLEPVFASIFAYMFLGETLTFKQLIGASFILLSMYLASKHLLK
Download sequence
Identical sequences A3DM03
399550.Smar_0556 WP_011838854.1.69113 gi|126465462|ref|YP_001040571.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]