SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DN55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DN55
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily AlbA-like 3.66e-25
Family DNA-binding protein AlbA 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A3DN55
Sequence length 98
Comment (tr|A3DN55|A3DN55_STAMF) DNA/RNA-binding protein Alba {ECO:0000256|HAMAP-Rule:MF_01122} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_0966 OC=Desulfurococcaceae; Staphylothermus.
Sequence
MAEAQPQAANTVLVGKKPVMNYVIAVLTLIHQGVKEIVVKARGRAISKAVDTVEIVRNRF
LPGKVDIEDINIGSQTVTNPAGRETRVSTIEIKLKVKE
Download sequence
Identical sequences A3DN55
399550.Smar_0966 WP_011839256.1.69113 gi|126465864|ref|YP_001040973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]