SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3DNV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3DNV9
Domain Number 1 Region: 11-218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.34e-59
Family Extended AAA-ATPase domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 231-322
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.4e-22
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3DNV9
Sequence length 329
Comment (sp|A3DNV9|RFCS_STAMF) Clamp loader small subunit {ECO:0000255|HAMAP-Rule:MF_01509} KW=Complete proteome; Reference proteome OX=399550 OS=F1). GN=Smar_1225; OC=Desulfurococcaceae; Staphylothermus.
Sequence
MSSSREVIAELLWAEKYRPKTLDEIVDQEEIVSRLKQFVKERNMPHLLFAGPPGTGKTTA
AHCLAHDLFGENYRQYMLELNASDERGIDVIRSKVKEFARTRVAANIPFKIVLLDEADNM
TADAQQALRRLMEMYTATTRFILIANYPSKIIEPIQSRCAVFRFAPLKKEDVISRLKWIA
EQEKVEIDEEALEAIHDLSEGDMRRAINILQAAAALGKVTVDSVYKVVGLAHPREIRQMI
QLALAGNFNDAREKLRELMINYGLSGVDVIKQVHREIFSTDIKIPDEFKIIIADLAGEIQ
FRLVEGADDEIQLNAFLARLAFLGKKLKP
Download sequence
Identical sequences A3DNV9
399550.Smar_1225 gi|126466118|ref|YP_001041227.1| WP_011839510.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]