SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3P4G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3P4G9
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000905
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3P4G9
Sequence length 100
Comment (tr|A3P4G9|A3P4G9_BURP0) Oxidoreductase, aldo/keto reductase family {ECO:0000313|EMBL:ABN94278.1} KW=Complete proteome OX=357348 OS=Burkholderia pseudomallei (strain 1106a). GN=BURPS1106A_A1194 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
MIAHRRQQASSPLRVSLPVSLGRRWALPALLDVAQRHPLLRLDLSFTDRRSDLVDEGIDR
AVRIGDPRGGSASLACRGLGRRPPGGLAIACRRTVFRNRV
Download sequence
Identical sequences A3P4G9
gi|403522493|ref|YP_006658062.1| gi|126457097|ref|YP_001075229.1| 357348.BURPS1106A_A1194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]