SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3PRU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A3PRU3
Domain Number 1 Region: 5-315
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.62e-59
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000285
Further Details:      
 
Domain Number 2 Region: 419-516
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 8.37e-39
Family D-aminopeptidase, middle and C-terminal domains 0.0000561
Further Details:      
 
Domain Number 3 Region: 333-413
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 7.32e-31
Family D-aminopeptidase, middle and C-terminal domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3PRU3
Sequence length 516
Comment (sp|A3PRU3|DAP_RHOS1) D-aminopeptidase {ECO:0000255|HAMAP-Rule:MF_01960} KW=Complete proteome OX=349101 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9). GN=Rsph17029_3981; OC=Rhodobacteraceae; Rhodobacter.
Sequence
MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPIC
SISKQFTCGVLLDTLGDTAAYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQG
AEATQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRIVSEILESETGRALPDLYAERI
FGPAGMRTAELTSDTRHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYES
WIDATRDDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGLKVTGHGGALRGFRAQRFH
AADERLSVVVIFNHEASAHAAASSLLAAALGHEAPKGAGPEGWAGQWLDPESGLLLRVGE
DAEGLTLRFATGPDRLTVGEDGVPRGAGVSLAREGATLVMNRTSDNLTVRAEPLPVVAVA
DAGEIAGRYHARELEADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDVWIVTTRRSMD
APAPGDWTLQVRREGGAVAGLRLGCWLARRIDYARV
Download sequence
Identical sequences A3PRU3
349101.Rsph17029_3981 WP_011842788.1.46944 gi|126464718|ref|YP_001045831.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]