SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A3QIF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A3QIF6
Domain Number - Region: 92-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000209
Family NfeD domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A3QIF6
Sequence length 153
Comment (tr|A3QIF6|A3QIF6_SHELP) Uncharacterized protein {ECO:0000313|EMBL:ABO25254.1} KW=Complete proteome; Reference proteome OX=323850 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4). GN=Shew_3388 OC=Shewanellaceae; Shewanella.
Sequence
MEFSNPIFIWIAVGLVLMLAEIILPGGIVIFLGAACVVVAGALTLGWVEGFVQALTLWFI
AAIVLLLAFRQLTQRLVGGDSHVDNTDEEFDLYNQVAVVKAVIGPAQQQGRVEFQGSEWP
ALGDGSEIPIGARVRVICRENIALVVEPLTEQA
Download sequence
Identical sequences A3QIF6
WP_011867184.1.33760 323850.Shew_3388 gi|127514316|ref|YP_001095513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]