SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4H7S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4H7S7
Domain Number 1 Region: 23-132,175-210
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.58e-37
Family Vacuolar sorting protein domain 0.0049
Further Details:      
 
Domain Number 2 Region: 293-337
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000256
Family Vacuolar sorting protein domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4H7S7
Sequence length 399
Comment (tr|A4H7S7|A4H7S7_LEIBR) Uncharacterized protein {ECO:0000313|EMBL:CAM37594.1} KW=Complete proteome; Reference proteome OX=5660 OS=Leishmania braziliensis. GN=LBRM_14_1240 OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence
MRRRVGVGHVLQERQQQQRMADLGAQITAERVGQIEDQLEELQAQLKTLAQNHKSDITED
PVVRARFRQLADSLGVDLLSSKKNVFADALGLGNFYYQLASRTVEACMRERKFCGAYVPL
QRVQFFVQKTYDNSSLLCGNGQSRHVSPHRGGSSGSSSGGGGKRGGRDEGKRIVISEADI
LTALSKLSVLGVGFNVVKLGGIPYIQTTPDGARGGDQVLLLNYVLGLQKEQIEKAKRTAV
QEQSKSMPTSSVNNSWTTAEGGSNQRNGVGAVYALGAHPFAFEKDKSSQANDALSFAQQC
VAVRESEIVSGLHWEAHRARAALRRMVQEGTAWVEESQDRPGDRATKTGAQGDSPEKSKA
VLSSFEEVKVVWKGKHKGTTETADKDDVVYWFVSLTSHA
Download sequence
Identical sequences A4H7S7
gi|154334317|ref|XP_001563410.1| XP_001563410.1.15230 psu|LbrM14_V2.1240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]