SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4HPH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4HPH2
Domain Number 1 Region: 361-614
Classification Level Classification E-value
Superfamily Cullin homology domain 8.89e-50
Family Cullin homology domain 0.00026
Further Details:      
 
Domain Number 2 Region: 16-366
Classification Level Classification E-value
Superfamily Cullin repeat-like 4.19e-41
Family Cullin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 628-705
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000044
Family SCF ubiquitin ligase complex WHB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4HPH2
Sequence length 706
Comment (tr|A4HPH2|A4HPH2_LEIBR) Cullin-like protein {ECO:0000313|EMBL:CAM44080.1} KW=Complete proteome; Reference proteome OX=5660 OS=Leishmania braziliensis. GN=LBRM_35_3280 OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence
MSSVVSSRKRMAEYSTFSDKWGIIEETVLCIFKKEVSRNSFQRIHHSVFQLCQAHYGSQV
LERLEEQLYAQVSTVLNRIEDSSVYVADFLREWQDYNDSVSQISNVLLYFNKNYMYACHH
SSIEHLGERIFCSSTLGNPEVSARLIASIKQSIHVPAAESIIRDIGQELYTAEGSKYFVR
CMETPFVDAIVDKYAAQGEQQKQALTTNSYLQWVQSVVSSESHKYADTFFYILLDKLTNA
LYSSLVLSDPSSVDDMLTGPTGLVHMLEEWDVTSISTVVQVFCAMKREKDVIDVIAQALK
EKSEGIINDRSTGVFPFPGVQKMLQLIERAKELDGLFAAEEGHSQSPFLRVIRNVLGSDT
RFMETLSVYYDNGIRQGKDDVVSTVGNNVLTILQLTPDLEAFEVAFRSHLAVRLIYAKPH
AVDMECRFIDRLFNIYGSSVVNRFQKMVEDIRSATAAQEKLVADMKTKKISPPLEFDVLV
LTSGLWPQYTNIPLSIPQSMESCKHVFQEYYRRRHNGRKLVFQMSLGSIAFQLCHGGRTY
HVSAHTHFVNSIMALNSDEDVSVAVVARQGALSSDEVLTHFNTLCHVGLAERNGTEFRFN
RRFYSSKSKVKVSAGVQKSAHDGSGGAIAACKGMDGARTMSLDATIVKLLKEHNSIDYHT
LCCAIESELRGVCSPTRTDIKLRVDALMEKGLLMRGESANCYVYCS
Download sequence
Identical sequences A4HPH2
gi|154346020|ref|XP_001568947.1| psu|LbrM35_V2.3280 XP_001568947.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]