SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4TBU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4TBU4
Domain Number 1 Region: 112-290,414-583
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.28e-99
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000885
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 6.98e-34
Family GAD domain 0.00051
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.67e-28
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4TBU4
Sequence length 590
Comment (sp|A4TBU4|SYDND_MYCGI) Non-discriminating aspartyl-tRNA synthetase {ECO:0000255|HAMAP-Rule:MF_00044} KW=Complete proteome OX=350054 OS=(strain ATCC 700033 / PYR-GCK)). GN=Mflv_3785; OC=Mycobacterium.
Sequence
MLRTRTAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVFRDGAVLEQAH
RLRSEFCVAVTGVVEIRPEGNANADIPTGEVEVNATSLTVLGESAALPFQLDETAGEEAR
LKYRYLDLRREVPGNAIRLRSKVNAAARGVLAGHDFVEIETPTLTRSTPEGARDFLVPAR
LQPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA
DDVMALSEEVLRAVWATIGYDLPLPLPRISYADAMRRFGSDKPDLRFGLELVECTEYFAD
TPFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGKDGELTGPVAKN
LTDAERAGLTAHVGANPGDCVFFAAGTAKSARALLGATRIEVAKRLDLIDPDAWAFTWVV
DWPMFESAAEATASGDVAVGSGAWTAMHHAFTAPTPESEATFDTDPGSALSNAYDIVCNG
NEIGGGSLRIHRRDVQERVFAMMGISQEEAEDKFGFLLEAFTFGAPPHGGIAFGWDRIVA
LLAGLDSIREVIAFPKSGGGVDPLTEAPAPITAQQRKESGIDAKPGKDGA
Download sequence
Identical sequences A4TBU4
gi|145224367|ref|YP_001135045.1| WP_011894637.1.11461 350054.Mflv_3785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]