SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4XC05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4XC05
Domain Number 1 Region: 44-148
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.12e-27
Family Anti-sigma factor antagonist SpoIIaa 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4XC05
Sequence length 151
Comment (tr|A4XC05|A4XC05_SALTO) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=369723 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440). GN=Strop_4032 OC=Salinispora.
Sequence
MGSVGSGRGACPTGRWWYPVSPVVMVECPWRVYGSCEEDLMELSLATRTVGEFAVVVVGG
EVDVYTAPQLREGLLELIDAGVEHVVVDLGGVDFLDSTGLGVLVGALKRLRTVGGSFALV
CDREPLLKIFRITALDQVFPLYPTVDAATGV
Download sequence
Identical sequences A4XC05
gi|145596543|ref|YP_001160840.1| 369723.Strop_4032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]