SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4XG14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4XG14
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 8.63e-19
Family TTHA0281-like 0.021
Further Details:      
 
Domain Number 2 Region: 71-111
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000245
Family Arc/Mnt-like phage repressors 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4XG14
Sequence length 161
Comment (tr|A4XG14|A4XG14_CALS8) Uncharacterized protein {ECO:0000313|EMBL:ABP65849.1} KW=Complete proteome; Reference proteome OX=351627 OS=Tp8T 6331). GN=Csac_0201 OC=Caldicellulosiruptor.
Sequence
MDYKVEIIKLSEEDGGGYLAIVPKLPGCMSDGSTPHEALENVQDAIKCWIETAREKGRQI
PPPDEYKEEEYSGRLVLRIPKSLHKHLAEEAKKEGVSLNSFIQHLISYALGCRENKTQEL
AIPYIPGSTLKGSIRKLFIKKEHYNPPVLQLGNFQQKDRSD
Download sequence
Identical sequences A4XG14
351627.Csac_0201 gi|146295269|ref|YP_001179040.1| WP_011915814.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]