SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4XGV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4XGV3
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000000549
Family TTHA0281-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A4XGV3
Sequence length 66
Comment (tr|A4XGV3|A4XGV3_CALS8) Uncharacterized protein {ECO:0000313|EMBL:ABP66138.1} KW=Complete proteome; Reference proteome OX=351627 OS=Tp8T 6331). GN=Csac_0501 OC=Caldicellulosiruptor.
Sequence
MLFTVIVSKEDNWYIAKCVENSVASQGKTIEEAIANLKETLELYYEGEEIQKPQMPPLIT
TIEVAV
Download sequence
Identical sequences A4XGV3
351627.Csac_0501 gi|146295558|ref|YP_001179329.1| WP_011916085.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]