SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4XLA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4XLA6
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 3.4e-20
Family TTHA0281-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4XLA6
Sequence length 138
Comment (tr|A4XLA6|A4XLA6_CALS8) Uncharacterized protein {ECO:0000313|EMBL:ABP67691.1} KW=Complete proteome; Reference proteome OX=351627 OS=Tp8T 6331). GN=Csac_2108 OC=Caldicellulosiruptor.
Sequence
MKKERYVFPAIFTFDDDGITIEFPDLPGCISCADTLDEAVKNAKEVLGLYLWSMEKDNEQ
IPEPTPVNNLKLEQNQIPMLIEVWMPLVRHEMDNKAVKKTLTIPQWLNMLAEKHNINFSQ
VLQEALKDKLGIKDYKHN
Download sequence
Identical sequences A4XLA6
gi|146297111|ref|YP_001180882.1| WP_011917622.1.85531 351627.Csac_2108 2005227514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]