SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4Y7C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4Y7C0
Domain Number 1 Region: 451-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4Y7C0
Sequence length 590
Comment (tr|A4Y7C0|A4Y7C0_SHEPC) Sulphate transporter {ECO:0000313|EMBL:ABP75853.1} KW=Complete proteome OX=319224 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453). GN=Sputcn32_2132 OC=Shewanellaceae; Shewanella.
Sequence
MEVNHVKFPSLVSFMPGLAQLLQYEKQWLRDDVRAGLSVAAVALPVAIAYAQLTGVNAAV
GLYSCVLPMLVYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDSMKHWQLVMTMTAMTG
FWCLIASRFRLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDERYLIERLTGAP
SYLSKTHWPTLLMGIVTLATYALIKRFRPLWPASMCAMAMAAFLVWVFNLTAFDINVVGE
VAAGLPSFYAPVFNLGIARELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRAL
GIANIASALSQGFAVSGADSRTAVNDANGGKSQLVSIIAAVLIALVALFFTAPLKYIPSS
ALGVVLVIASISLIDLKALWNLRVRDRSAFLLACITLFSVLFIGVIPGITLAVLLGLFQF
LATVMRPTDQVLGLDEKGVIRSIDDSGKAKPVPGVFIYRFNSPLTYFNATYFKRRLLEKF
VREPEPVDCIIIDAVPCFTHLDLSVMAMLADLHQLLKKRGVRLVLAGRKRQMLGWFELTG
MQTGEGGILVRPDLYLALKMNQSYKQALAEGQAPVIQKLPDDSVLLHSHL
Download sequence
Identical sequences A4Y7C0
319224.Sputcn32_2132 351745.Sputw3181_1879 gi|120598694|ref|YP_963268.1| gi|146293228|ref|YP_001183652.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]