SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4YD23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4YD23
Domain Number 1 Region: 91-166
Classification Level Classification E-value
Superfamily Single hybrid motif 3.14e-21
Family Biotinyl/lipoyl-carrier proteins and domains 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A4YD23
Sequence length 167
Comment (tr|A4YD23|A4YD23_METS5) Biotin carboxyl carrier protein {ECO:0000313|EMBL:ABP94325.1} KW=Complete proteome; Reference proteome OX=399549 OS=15509 / TH2). GN=Msed_0148 OC=Metallosphaera.
Sequence
MKLYRVHADTGDTFIVAHDQKENKDRLKTENNEFEIEYVGQGTREGEIILKINGEMHRVF
IDNGWIILDNARIFRAERVTELPTQEGQTLDEMIKGKEGEVLSPLQGRVVQVRVKEGDAV
NKGQPLLSIEAMKSETIVSAPISGLVEKVLVKAGQGVKKGDILVVIK
Download sequence
Identical sequences A4YD23 Q8J2Z3
WP_011921293.1.15515 WP_011921293.1.27320 WP_011921293.1.28583 WP_011921293.1.31166 WP_011921293.1.34633 WP_011921293.1.8883 WP_011921293.1.99084 gi|146302933|ref|YP_001190249.1| 399549.Msed_0148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]