SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A4YIG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A4YIG2
Domain Number 1 Region: 186-420
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.56e-66
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000448
Further Details:      
 
Domain Number 2 Region: 9-188
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 7.36e-63
Family Aminoacid dehydrogenases 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A4YIG2
Sequence length 421
Comment (tr|A4YIG2|A4YIG2_METS5) Glutamate dehydrogenase {ECO:0000256|PIRNR:PIRNR000185} KW=Complete proteome; Reference proteome OX=399549 OS=15509 / TH2). GN=Msed_2074 OC=Metallosphaera.
Sequence
MTSVEEVLTSNLYTQQTKKLYKIGEILGLHEDQLTALSTPERVIQVKIQIKGKDGTIKTF
TGWRSQHNSALGPYKGGVRFHPNVTQDEVIALSMIMTWKNSLLQLPYGGGKAGVRVDPKS
LSKEELEQLSRNFIDAIYKYIGSDIDVPAPDVNTDSQIMSWFLDEYTKISGKIDPATFTG
KPIDLGGLAVREFSTGLGVVHTAKLAAEKFLGGLEGRRVIIQGFGNLGSFAAKFFEENGA
IVIGVSDSKGGVIDPNGLSYSKLEEVKKSTGSVVNYPSGKKVTNDELLITETDILVPAAL
ENVIHKYNAPKIKAKLIVEGANGPLTADADAILKERGIPVVPDILANSGGVVGSYVEWAN
NRMGEIINEEDAKKLILSRMEKAFSEVYIKYNSLSDQDLRTAAMVVAVERVVRAMKVRGL
I
Download sequence
Identical sequences A0A088E934 A4YIG2
399549.Msed_2074 WP_012022001.1.15515 WP_012022001.1.27320 WP_012022001.1.28583 WP_012022001.1.31166 WP_012022001.1.34633 WP_012022001.1.8883 WP_012022001.1.99084 gi|146304822|ref|YP_001192138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]