SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5BZK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5BZK7
Domain Number 1 Region: 43-184
Classification Level Classification E-value
Superfamily PapD-like 5.23e-34
Family MSP-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A5BZK7
Sequence length 240
Comment (tr|A5BZK7|A5BZK7_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CAN75162.1} OX=29760 OS=Vitis vinifera (Grape). GN=VITISV_017383 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MPFWQSNNASSSSSTSSSLQSVHQQSQSHQVLQSSNAVSFVTKSLLPTRRRLHLDPPNKL
YFPYEPGKQVRSAISIKNISRSHLAFKFQTTAPKSCYMRPPGGILAPGESLIATVFKFVE
HPENNEKPAVDQKSKVKFKIMSLKVKGEMDYVPELFDEQKDQVAEEQILRVVFLDTERPS
PPLEKLKRQLAEAEAALEARKKPPEDTGPRIVGEGLVIDEWKERRERYLARQQVEGIDSV
Download sequence
Identical sequences A5BZK7
GSVIVT01030002001 29760.GSVIVG00029184001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]