SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5G5U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5G5U9
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5G5U9
Sequence length 120
Comment (tr|A5G5U9|A5G5U9_GEOUR) Sulfate transporter/antisigma-factor antagonist STAS {ECO:0000313|EMBL:ABQ27167.1} KW=Complete proteome; Reference proteome OX=351605 OS=Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens). GN=Gura_2995 OC=Geobacteraceae; Geobacter.
Sequence
MAVFEVSTTTSEGEPSTVVVSISGSMTVQYAGELKTALLTVLDSAEQIRLDVGNVTEVDL
AGLQLLCSAHRTSVQLNKQFVFCDGYNEVVKKIGREAGFQRHVGCALDKGKSCIWVGGKH
Download sequence
Identical sequences A5G5U9
WP_011939836.1.63777 351605.Gura_2995 gi|148265034|ref|YP_001231740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]