SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A5UGR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A5UGR0
Domain Number 1 Region: 4-192
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 4.19e-72
Family Peptidyl-tRNA hydrolase-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A5UGR0
Sequence length 194
Comment (sp|A5UGR0|PTH_HAEIG) Peptidyl-tRNA hydrolase {ECO:0000255|HAMAP-Rule:MF_00083} KW=Complete proteome OX=374931 OS=Haemophilus influenzae (strain PittGG). GN=CGSHiGG_05145; OC=Pasteurellaceae; Haemophilus.
Sequence
MSEIKLIVGLGNPGEKYADTRHNAGEWLIERLARRFNVSLNPESKFFGKTVRTLVNGKEV
RLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPAGTAKLKQGGGHGGHNGLKD
IVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRNALEKVLDEATDCVEMIFKD
GMIKATNRLNSFKI
Download sequence
Identical sequences A5UGR0
gi|148827596|ref|YP_001292349.1| 374931.CGSHiGG_05145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]