SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6Q0K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6Q0K4
Domain Number 1 Region: 86-198
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.44e-36
Family Frataxin-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6Q0K4
Sequence length 211
Comment (tr|A6Q0K4|A6Q0K4_CANLF) Frataxin {ECO:0000313|EMBL:CAO03078.1, ECO:0000313|Ensembl:ENSCAFP00000036075} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=fxn OC=Canis.
Sequence
MWTLGRRAAAGLLPRSAPPGSAAAGAGTRGPTRAAPLHGGRGLRVGTGAARGPSHANLSL
HHLNQLVNVKKQSVCLMNMRTVGTVSSPGSLDETTYERLAETTLDSLAEFFEDLADKPYT
LEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDG
VSLHELLATELTKAFKIKLDLSSLAYSGKGT
Download sequence
Identical sequences A6Q0K4
ENSCAFP00000036075 NP_001103428.1.84170 ENSCAFP00000036075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]