SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6SZT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6SZT4
Domain Number 1 Region: 163-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.1e-71
Family Methylesterase CheB, C-terminal domain 0.000000222
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 1.01e-28
Family CheY-related 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6SZT4
Sequence length 359
Comment (tr|A6SZT4|A6SZT4_JANMA) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=375286 OS=Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis). GN=mma_2091 OC=Oxalobacteraceae; Janthinobacterium.
Sequence
MKIKVLIVDDSALIRSVMKEIINSQPDMEVVGVAPDPIVARDLIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSDITLRALELGAVDFVTKPKMSIQSGMLEYTE
LIADKIRTASKARIKSRQITPHDPNKVAGDGVLPLIRNPLTSSEKLIIIGASTGGTEAIK
DFLMQMPSDCPGILITQHMPPGFTKSFAQRLDSLCKISVKESEGGERVLPGHAYLAPGHS
HLQLVRSGANYMTQLDQGPPVNRHRPSVDVLFHSAAVHAGKNAVGVILTGMGKDGALGML
EMKNVGAYNFAQDEASCVVFGMPREAIAVGATHEVGPLNALPGMVLGYLAAHSSRALRV
Download sequence
Identical sequences A6SZT4
WP_012079944.1.39695 375286.mma_2091 gi|152980521|ref|YP_001353781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]