SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6TAP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6TAP4
Domain Number 1 Region: 442-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000118
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6TAP4
Sequence length 550
Comment (tr|A6TAP4|A6TAP4_KLEP7) Putative sulfate transporter {ECO:0000313|EMBL:ABR77665.1} KW=Complete proteome; Reference proteome OX=272620 OS=78578). GN=KPN_02239 OC=Enterobacteriaceae; Klebsiella.
Sequence
MPFRALIDACWKEKYTTARFTRDLIAGITVGIIAIPLAMALAIGSGVPPQYGLYTSAVAG
IVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLMSGIFLILFGLARFGRLIE
YIPLSVTLGFTSGIGITIGTMQIKDFLGLQMPHVPEHYLQKVAALAMALPTINVGDAAIG
VVTLGILILWPRLGIRLPGHLPALLGGCAVMLVVNLLGGDVATIGSQFHYQLADGTQGNG
IPQLLPQLVLPWDMPGSNFTLSWASLQALLPAAFSMAMLGAIESLLCAVVLDGMTGTKHK
ANSELIGQGLGNIVAPFFGGITATAAIARSAANVRAGATSPVAAVIHALLVILALLILAP
LLSWLPLSAMAALLLMVAWNMSEAHKVINLLRHAPKDDIVVMLMCMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTHLAPVNVEVPDDVLVLRVIGPLFFAAAEGLFNDLETRIAGKRI
VVLKWDAVPVLDAGGLDAFQRFVNKLPEGCELRVSNLEFQPLRTLARAGVKPLPGRLSFY
PDRQAALADL
Download sequence
Identical sequences A0A1D3KTL5 A6TAP4 V0AYH6
gi|152970786|ref|YP_001335895.1| WP_004175549.1.97759 272620.KPN_02239 GO.8817 gi|402780250|ref|YP_006635796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]